2.50 Rating by CuteStat

It is a domain having de extension. It has a global traffic rank of #1357833 in the world. This website is estimated worth of $ 960.00 and have a daily income of around $ 4.00. As no active threats were reported recently by users, entwicklungsdienst.de is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 620
Daily Pageviews: 1,240

Estimated Valuation

Income Per Day: $ 4.00
Estimated Worth: $ 960.00

Search Engine Indexes

Google Indexed Pages: 1,900
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 130,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,357,833
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

185.227.114.142

Hosted Country:

Germany DE

Location Latitude:

51.2993

Location Longitude:

9.491

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 3 H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: 5
H5 Headings: Not Applicable H6 Headings: 7
Total IFRAMEs: Not Applicable Total Images: 4
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 11 Dec 2019 19:49:45 GMT
Server: Apache
Content-Language: de
Content-Encoding: gzip
Vary: Accept-Encoding
Content-length: 7168
Cache-Control: max-age=0
Expires: Wed, 11 Dec 2019 19:49:45 GMT
X-UA-Compatible: IE=edge
X-Content-Type-Options: nosniff
Content-Type: text/html; charset=utf-8

Domain Nameserver Information

Host IP Address Country
dns.typo3server.com 81.3.28.186 Germany Germany
ns2.typo3server.com 188.94.252.153 Germany Germany
ns3.dnsmittwald.de 188.94.251.53 Germany Germany

DNS Record Analysis

Host Type TTL Extra
entwicklungsdienst.de A 10798 IP: 185.227.114.142
entwicklungsdienst.de NS 86400 Target: ns2.typo3server.com
entwicklungsdienst.de NS 86400 Target: ns3.dnsmittwald.de
entwicklungsdienst.de NS 86400 Target: dns.typo3server.com
entwicklungsdienst.de SOA 3600 MNAME: dns.typo3server.com
RNAME: support.mittwald.de
Serial: 1902150005
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
entwicklungsdienst.de MX 86400 Priority: 10
Target: mx2.agenturserver.de
entwicklungsdienst.de MX 86400 Priority: 20
Target: mx3.agenturserver.de
entwicklungsdienst.de MX 86400 Priority: 50
Target: mx4.agenturserver.de
entwicklungsdienst.de MX 86400 Priority: 10
Target: mx1.agenturserver.de

Similarly Ranked Websites

MyanPay E-commerce System

- myanpay.com.mm
1,357,839 $ 960.00

Каталог одежды Бонприкс. Модная одежда Bonprix

- bonprix-catalog.ru

Каталог одежды Бонприкс. Действующий каталог Bonprix в удобном формате для просмотра. Все актуальные и новые каталоги Бонприкс в одном месте и в отличном качестве.

1,357,840 $ 480.00

My blog | Just another WordPress site

- impresivefunnyxd.com
1,357,841 $ 480.00

Happy Valentines Day Images Happy Valentines day Wishes pics

- happyvalentinesdayimageswishes.com

Happy Valentines Day Images Happy Valentines day Wishes Valentin's Day Images Valentine's day wishes Happy valentines day Pictures Rose day Images And

1,357,841 $ 480.00

Ariel Atom Chat

- arielatomchat.com

Worldwide Ariel Atom discussion forum for all Ariel Atom owners and enthusiasts. Technical discussion, marketplace, photos, videos, parts, and more.

1,357,842 $ 960.00

Full WHOIS Lookup

% Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: entwicklungsdienst.de
Nserver: dns.typo3server.com
Nserver: ns2.typo3server.com
Nserver: ns3.dnsmittwald.de
Status: connect
Changed: 2018-01-31T12:07:26+01:00