Web Analysis for Entwicklungsdienst - entwicklungsdienst.de
2.50
Rating by CuteStat
It is a domain having de extension. It has a global traffic rank of #1357833 in the world. This website is estimated worth of $ 960.00 and have a daily income of around $ 4.00. As no active threats were reported recently by users, entwicklungsdienst.de is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | 620 |
Daily Pageviews: | 1,240 |
Estimated Valuation
Income Per Day: | $ 4.00 |
Estimated Worth: | $ 960.00 |
Search Engine Indexes
Google Indexed Pages: | 1,900 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 130,000 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 1,357,833 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 3 | H2 Headings: | 2 |
H3 Headings: | Not Applicable | H4 Headings: | 5 |
H5 Headings: | Not Applicable | H6 Headings: | 7 |
Total IFRAMEs: | Not Applicable | Total Images: | 4 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Wed, 11 Dec 2019 19:49:45 GMT
Server: Apache
Content-Language: de
Content-Encoding: gzip
Vary: Accept-Encoding
Content-length: 7168
Cache-Control: max-age=0
Expires: Wed, 11 Dec 2019 19:49:45 GMT
X-UA-Compatible: IE=edge
X-Content-Type-Options: nosniff
Content-Type: text/html; charset=utf-8
Date: Wed, 11 Dec 2019 19:49:45 GMT
Server: Apache
Content-Language: de
Content-Encoding: gzip
Vary: Accept-Encoding
Content-length: 7168
Cache-Control: max-age=0
Expires: Wed, 11 Dec 2019 19:49:45 GMT
X-UA-Compatible: IE=edge
X-Content-Type-Options: nosniff
Content-Type: text/html; charset=utf-8
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns.typo3server.com | 81.3.28.186 | Germany | |
ns2.typo3server.com | 188.94.252.153 | Germany | |
ns3.dnsmittwald.de | 188.94.251.53 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
entwicklungsdienst.de | A | 10798 |
IP: 185.227.114.142 |
entwicklungsdienst.de | NS | 86400 |
Target: ns2.typo3server.com |
entwicklungsdienst.de | NS | 86400 |
Target: ns3.dnsmittwald.de |
entwicklungsdienst.de | NS | 86400 |
Target: dns.typo3server.com |
entwicklungsdienst.de | SOA | 3600 |
MNAME: dns.typo3server.com RNAME: support.mittwald.de Serial: 1902150005 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 3600 |
entwicklungsdienst.de | MX | 86400 |
Priority: 10 Target: mx2.agenturserver.de |
entwicklungsdienst.de | MX | 86400 |
Priority: 20 Target: mx3.agenturserver.de |
entwicklungsdienst.de | MX | 86400 |
Priority: 50 Target: mx4.agenturserver.de |
entwicklungsdienst.de | MX | 86400 |
Priority: 10 Target: mx1.agenturserver.de |
Similarly Ranked Websites
Каталог одежды Бонприкс. Модная одежда Bonprix
- bonprix-catalog.ru
Каталог одежды Бонприкс. Действующий каталог Bonprix в удобном формате для просмотра. Все актуальные и новые каталоги Бонприкс в одном месте и в отличном качестве.
1,357,840
$
480.00
Happy Valentines Day Images Happy Valentines day Wishes pics
- happyvalentinesdayimageswishes.com
Happy Valentines Day Images Happy Valentines day Wishes Valentin's Day Images Valentine's day wishes Happy valentines day Pictures Rose day Images And
1,357,841
$
480.00
Ariel Atom Chat
- arielatomchat.com
Worldwide Ariel Atom discussion forum for all Ariel Atom owners and enthusiasts. Technical discussion, marketplace, photos, videos, parts, and more.
1,357,842
$
960.00
Full WHOIS Lookup
% Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%
Domain: entwicklungsdienst.de
Nserver: dns.typo3server.com
Nserver: ns2.typo3server.com
Nserver: ns3.dnsmittwald.de
Status: connect
Changed: 2018-01-31T12:07:26+01:00
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%
Domain: entwicklungsdienst.de
Nserver: dns.typo3server.com
Nserver: ns2.typo3server.com
Nserver: ns3.dnsmittwald.de
Status: connect
Changed: 2018-01-31T12:07:26+01:00